Recombinant Human Kelch-Like 3 GST (N-Term) Protein

Name: Recombinant Human Kelch-Like 3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00026249-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00026249-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Kelch-Like 3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-301 of Human KLHL3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVEIEAHRVVLAACSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENVQVLLPAASLLQLMDVRQNCCDFLQSQLHPTNCLGIRAFADVHTCTDLLQQANAYAEQHFPEVMLGEEFLSLSLDQVCSLISSDKLTVSSEEKVFEAVISWINYEKETRLEHMAKLMEHVRLPLLPRDYLVQTVEEEALIKNNNTCKDFLIEAMKYHLLPLDQRLLIKNPRTKPRTPVSLPK

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

60.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Kelch-Like 3 GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00026249-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Kelch-Like 3

KLHL3, also known as Kelch-like protein 3; has 3 isoforms, a 65 kDa 587 amino acid isoform A, a 61 kDa 555 amino acid isoform B, and a 56 kDa 505 amino acid isoform C; acts as a substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex that plays a role of regulator in ion transport of the distal nephron. The BCR(KLHL3) complex may regulate the SLC12A3/NCC subcellular location at the cell membrane by mediating ubiquitination of SLC12A3/NCC. There has been research revolving around the KLHL3 protein involvement in pharyngitis and pseudohypoaldosteronism. The protein has been shown to interact with OPRD1, GNAO1, SYT2, SYNCRIP, and GNAI1 proteins in protein ubiquitination, renal sodium ion absorption, and distal tubule morphogenesis pathways.

Alternate Names

FLJ40871, kelch-like 3 (Drosophila), kelch-like protein 3, KIAA1129kelch (Drosophila)-like 3, MGC44594

Gene Symbol

KLHL3

Additional Kelch-Like 3 Products

Product Documents for Recombinant Human Kelch-Like 3 GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Kelch-Like 3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews