L-Selectin/CD62L Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP2-76545PEP
Key Product Details
Source
E. coli
Conjugate
Unconjugated
Applications
Antibody Competition
Product Specifications
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human L-Selectin/CD62L.
Source: E. coli
Amino Acid Sequence: MGCRRTREGPSKAMIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTD
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Antibody Competition (10-100 molar excess)
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76545.
It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.
For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
For further blocking tide related information and a protocol, click here.
Protein / Peptide Type
Recombinant Protein Antigen
Formulation, Preparation and Storage
NBP2-76545PEP
| Formulation | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: L-Selectin/CD62L
L-selectin expressed on leukocytes binds to ligands expressed by endothelial cells where it plays a role in lymphocyte homing to secondary lymphoid organs (2-5). L-selectin specifically recognizes and binds to sulfated sialyl-Lewis epitopes of O-linked glycans (2-4). Ligands for L-selectin include glycosylation-dependent cell adhesion molecule-1 (GlyCAM-1), CD34, mucosal vascular addressin cell adhesion molecule-1 (MAdCAM-1), and P-selectin glycoprotein ligand-1 (PSGL-1) (2,4). Elevated levels of selectin ligands on tumor cells are associated with cancer progression and metastasis (3). High levels of L-selectin and soluble L-selectin (sL-selectin) has been implicated in a number of pathologies from viral infection and allergies, to sepsis and multiple sclerosis (2,4,5). For example, L-selectin has been shown to play a role in human immunodeficiency virus (HIV) infection. HIV envelope glycans, such as gp120, binds to L-selectin/CD62L on CD4+ T cells, facilitating viral adhesion (2,5). A disintegrin and metalloproteinase (ADAM)17 is the primary enzyme responsible for L-selectin shedding in leukocytes, which is triggered in response to inflammatory signals (1,2,5). AMAD17 inhibitors block L-selectin shedding and reduce viral release (2,5). Given their role in cancer and other diseases, selectins and their ligands are potential targets for therapeutic intervention (3,5). For instance, murine models have shown that anti-L-selectin antibodies can delay onset of graft versus host disease (5).
References
1. Ivetic A. (2018). A head-to-tail view of L-selectin and its impact on neutrophil behaviour. Cell and Tissue Research, 371(3), 437-453. https://doi.org/10.1007/s00441-017-2774-x
2. Ivetic, A., Hoskins Green, H. L., & Hart, S. J. (2019). L-selectin: a major regulator of leukocyte adhesion, migration and signaling. Frontiers in Immunology, 10, 1068. https://doi.org/10.3389/fimmu.2019.01068
3. Borsig L. (2018). Selectins in cancer immunity. Glycobiology, 28(9), 648-655. https://doi.org/10.1093/glycob/cwx105
4. Kneuer, C., Ehrhardt, C., Radomski, M. W., & Bakowsky, U. (2006). Selectins-potential pharmacological targets?. Drug Discovery Today, 11(21-22), 1034-1040. https://doi.org/10.1016/j.drudis.2006.09.004
5. Segura, J., He, B., Ireland, J., Zou, Z., Shen, T., Roth, G., & Sun, P. D. (2021). The role of L-Selectin in HIV infection. Frontiers in Microbiology, 12, 725741. https://doi.org/10.3389/fmicb.2021.725741
Alternate Names
CD62L, hLHRc, LAM1, LECAM1, Leu-8, LNHR, LSEL, Lyam-1, LYAM1, PLNHR, SELL, TQ1
Gene Symbol
SELL
Additional L-Selectin/CD62L Products
Product Documents for L-Selectin/CD62L Recombinant Protein Antigen
Product Specific Notices for L-Selectin/CD62L Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...