Recombinant Human Latrophilin 1/LPHN1 Protein

Name: Recombinant Human Latrophilin 1/LPHN1 Protein
Brand: Novus Biologicals
SKU: H00022859-G01

Novus Biologicals, part of Bio-Techne | Catalog # H00022859-G01

Submit a review

Product Datasheet / COA

100% Guarantee

Technical Data
Citations & Reviews

Product Specifications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Conjugate

Unconjugated

Applications

Affinity Purification

View all Latrophilin 1/LPHN1 Proteins and Enzymes »

Product Specifications

Description

An untagged recombinant protein corresponding to the amino acid sequence of (AAH19928.1) for Human Latrophilin 1/LPHN1

Source: Wheat Germ (in vitro) with proprietary liposome technology

Amino Acid Sequence: MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

20.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Formulation, Preparation and Storage

H00022859-G01

Preparation Method	in vitro wheat germ expression system with proprietary liposome technology
Formulation	25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Preservative	Glycerol
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Latrophilin 1/LPHN1

Latrophilin-1 is a brain-specific Orphan-B Receptor that binds alpha-latrotoxin, a potent presynaptic neurotoxin present in the venom of the black widow spider, in a Ca2+-independent manner. As with the other two latrophilins, it shares homology with lectin, olfactomedin, and transmembrane domains, and possesses variable C-termini and various alternative-splicing sites. CIRL is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. Latrophilin-1 has been reported to be expressed predominantly in the brain. Very weak expression has also been documented in human heart, placenta, lung, liver, skeletal muscle, kidney, and pancreas. ESTs have been isolated from brain, eye, kidney, lung, and lymph node libraries. In addition, ESTs have been isolated from the following cancer libraries: brain, choriocarcinoma, epithelioid carcinoma, kidney, and lung.

Alternate Names

CIRL1, LEC2, Lectomedin-2, LPHN1

Gene Symbol

ADGRL1

Additional Latrophilin 1/LPHN1 Products

Product Documents for Recombinant Human Latrophilin 1/LPHN1 Protein

Product Datasheets

Download Product Datasheets

COA

Product Specific Notices for Recombinant Human Latrophilin 1/LPHN1 Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews