Skip to main content

LIN-28A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21320PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP3-21320PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIN-28A

Source: E.coli

Amino Acid Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21320. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP3-21320PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LIN-28A

lin-28 homolog (C. elegans), also known as CSDD1, ZCCHC1. Entrez Protein NP_078950. LIN28 was first discovered in the nematode C. elegans. It is a heterochronic protein in C. elegans involved in the timing of developmental events and choice of stage specific cell fates. LIN28 expression has been found to be regulated post-transcriptionally by miRNAs in both nematodes and mammals. In humans it is expressed in embryonic stem cells and its expression decreases during differentiation. It is negatively regulated by retinoic acid in neuronal differentiation.

Long Name

RNA-binding Protein LIN-28

Alternate Names

CSDD1, LIN28, LIN28A, Tex17, ZCCHC1

Gene Symbol

LIN28A

Additional LIN-28A Products

Product Documents for LIN-28A Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LIN-28A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...