Lipase A Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-47397PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-47397PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all LIPA Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIPA.

Source: E. coli

Amino Acid Sequence: FALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47397.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-47397PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LIPA

Lipase A, also known as LIPA or Lysosomal acid lipase/cholesteryl ester hydrolase, has a 399 amino acid long isoform that is 45 kDa and a short 343 amino acid isoform that is 39 kDa; lysosome located; is very important for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles, and also in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. This protein is currently being studied for involvement in the following diseases and disorders: cholesteryl ester storage disease, wolman disease, cholesterol, cholesterol ester storage disease, lysosomal storage disease, coronary heart disease, hepatitis c, splenomegaly, hepatitis b, hepatitis, hyperlipidemia, hypercholesterolemia, tuberculosis, obesity atherosclerosis, alzheimer's disease, neisseria meningitides, lipid storage disease, lipodystrophy, pandas, wolman disease, and blepharitis. The LIPA protein has been shown to interact with HIST1H4A, HIST1H4B, HIST1H4C, SOAT1, and HIST1H4E in cholesterol and sphingolipids transport / distribution to the intracellular membrane compartments (normal and CF), steroid biosynthesis, and lysosome pathways.

Long Name

Lipase A

Alternate Names

CESD, Lipase A

Gene Symbol

LIPA

Additional LIPA Products

Product Documents for Lipase A Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Lipase A Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.