LYVE-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38500PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38500PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all LYVE-1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LYVE1.

Source: E. coli

Amino Acid Sequence: FETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38500.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38500PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: LYVE-1

LYVE-1 (Lymphatic Vessel Endothelial Receptor 1) is a receptor for the extracellular matrix mucopolysaccharide hyaluronan (HA) and is primarily expressed by lymphatic endothelial cells in addition to the sinusoidal endothelium of the liver and spleen (1-3). HA, also called hyaluronic acid, is a main component of the extracellular matrix and functions largely in cell adhesion, migration, and tissue remodeling (2). HA undergoes a turnover process that involves release from the tissues to the afferent lymph, degradation within the lymph nodes, and removal of fragments by the liver (2,3). LYVE-1, in addition to other lymphatic proteins including VEGFR3, Prox1, and podoplanin, is a common marker for differentiating between the blood and lymphatic systems (2,3). Furthermore, LYVE-1 is closely related to the leukocyte receptor CD44, having ~44% sequence similarity (1-3). Like CD44, the LYVE-1 protein contains an extracellular HA-binding link domain, with N- and C-terminal extensions, located at the end of a glycosylated juxtamembrane domain stalk region, followed by a transmembrane region, and a cytoplasmic tail (1-3). The key features of the HA-binding like molecule are the three disulfide bridges formed by six cysteine residues (1-3). LYVE-1 is synthesized as a protein of 322 amino acids in length with a theoretical molecular weight of 35 kDa, although due to O-glycosylation often appears in SDS-PAGE at a molecular weight ranging from ~60-70 kDa (2,4). The role of HA-binding is further elucidated by the identification of LYVE-1 as a docking receptor for dendritic cells and macrophages, binding their surface HA to control the entry and migration into lymph vessels (1).

LYVE-1 has been an important marker in studies of embryonic and tumor lymphangiogenesis, as many cancers are characterized by early metastasis to the lymph nodes (1-3, 5). One study of five different vascular tumors in infants used immunohistochemical analysis and found positive LYVE-1 expression in infantile hemangioma, tufted angioma, and kaposiform hemangioendothelioma (5). LYVE-1 along with other markers such as GLUT-1, CD31, CD34, Prox-1, and WT-1 can be used to help provide immunohistologic profiles of various tumors and, when used in conjunction with clinical and histopathologic approaches, may offer better overall diagnosis and disease treatment (5).

References

1. Jackson D. G. (2019). Hyaluronan in the lymphatics: The key role of the hyaluronan receptor LYVE-1 in leucocyte trafficking. Matrix Biology : Journal of the International Society for Matrix Biology. https://doi.org/10.1016/j.matbio.2018.02.001

2. Jackson D. G. (2004). Biology of the lymphatic marker LYVE-1 and applications in research into lymphatic trafficking and lymphangiogenesis. APMIS : acta pathologica, microbiologica, et immunologica Scandinavica. https://doi.org/10.1111/j.1600-0463.2004.apm11207-0811.x

3. Jackson D. G. (2003). The lymphatics revisited: new perspectives from the hyaluronan receptor LYVE-1. Trends in Cardiovascular Medicine. https://doi.org/10.1016/s1050-1738(02)00189-5

4. Unitprot (Q9Y5Y7)

5. Johnson, E. F., Davis, D. M., Tollefson, M. M., Fritchie, K., & Gibson, L. E. (2018). Vascular Tumors in Infants: Case Report and Review of Clinical, Histopathologic, and Immunohistochemical Characteristics of Infantile Hemangioma, Pyogenic Granuloma, Noninvoluting Congenital Hemangioma, Tufted Angioma, and Kaposiform Hemangioendothelioma. The American Journal of Dermatopathology. https://doi.org/10.1097/DAD.0000000000000983

Long Name

Lymphatic Vessel Endothelial Hyaluronan Receptor 1

Alternate Names

LYVE1, XLKD1

Gene Symbol

LYVE1

Additional LYVE-1 Products

Product Documents for LYVE-1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for LYVE-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.