Skip to main content

MALT1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-55513PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-55513PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MALT1.

Source: E. coli

Amino Acid Sequence: KVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55513.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-55513PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MALT1

Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (MALT1), also known as MLT1 or paracaspase 1, is a member of the human paracaspase family and an interacting partner of B-cell lymphoma 10 (Bcl-10) (1). In vitro, In vitro, MALT1 synergizes with BCL10 to enhance nuclear factor B activation (2) and to mediate IB kinase (IKK) activation by facilitating the ubiquitinylation of the NF-B essential modulator (NEMO) (3). MALT1 is found in recurrent chromosomal translocations in non-Hodgkin B-cell lymphoma of the mucosa-associated lymphoid tissue (MALT). One common translocation juxtaposes the MALT1 gene to the IgH promoter region, resulting in up-regulation of Bcl-10 and MALT1 (4). Another common translocation creates a fusion between MALT1 and the inhibitor of apoptosis gene API2 (cIAP2/HIAP1) (5).

Long Name

Mucosa Associated Lymphoid Tissue Lymphoma Translocation Gene 1

Alternate Names

MLT1, Paracaspase

Gene Symbol

MALT1

Additional MALT1 Products

Product Documents for MALT1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MALT1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...