MAP2 Recombinant Protein Antigen
Novus Biologicals, part of Bio-Techne | Catalog # NBP3-21231PEP
Key Product Details
Source
Conjugate
Applications
Product Specifications
Description
Source: E.coli
Amino Acid Sequence: EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Purity
Predicted Molecular Mass
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Applications
Application Notes
Protein / Peptide Type
Formulation, Preparation and Storage
NBP3-21231PEP
Formulation | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
Shipping | The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below. |
Stability & Storage | Store at -20C. Avoid freeze-thaw cycles. |
Background: MAP2
MAP2 isoforms are developmentally regulated and differentially expressed in neurons and some glia. MAP2c is predominantly expressed in the developing brain while the other isoforms are expressed in the adult brain. The distribution of MAP2 isoforms also varies, with MAP2a and MAP2b predominantly localized to dendrites, while MAP2c is also found in axons. Lastly, the expression of MAP2d is not limited to neurons and may be found in glia, specifically oligodendrocytes (1, 2). MAP2 isoforms associate with microtubules and mediate their interaction with actin filaments thereby playing a critical role in organizing the microtubule-actin network. In neurons, MAP2 isoforms are implicated in different processes including neurite initiation, elongation and stabilization as well as axon and dendrite formation (2). Knockout of MAP expression in animal models results in a variety of functional and structural brain defects according to the isoform affected (e.g., reduced LTP and LTD, reduced myelination, absence of corpus collosum, motor system malfunction, abnormal hippocampal dendritic morphology, abnormal synaptic plasticity) (4).
References
1. Dehmelt, L., & Halpain, S. (2005). The MAP2/Tau family of microtubule-associated proteins. Genome Biology. https://doi.org/10.1186/gb-2004-6-1-204
2. Mohan, R., & John, A. (2015). Microtubule-associated proteins as direct crosslinkers of actin filaments and microtubules. IUBMB Life. https://doi.org/10.1002/iub.1384
3. Shafit-Zagardo, B., & Kalcheva, N. (1998). Making sense of the multiple MAP-2 transcripts and their role in the neuron. Molecular Neurobiology. https://doi.org/10.1007/BF02740642
4. Tortosa, E., Kapitein, L. C., & Hoogenraad, C. C. (2016). Microtubule organization and microtubule-associated proteins (MAPs). In Dendrites: Development and Disease. https://doi.org/10.1007/978-4-431-56050-0_3
Long Name
Alternate Names
Gene Symbol
Additional MAP2 Products
Product Documents for MAP2 Recombinant Protein Antigen
Product Specific Notices for MAP2 Recombinant Protein Antigen
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.