Skip to main content

MDGA1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38624PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-38624PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MDGA1.

Source: E. coli

Amino Acid Sequence: EVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVGSAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38624.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38624PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MDGA1

MDGA-1 (MAM domain-containing GPI anchor protein 1) is a 135-140 kDa, novel member of the Ig-superfamily. It is expressed on embryonic neurons destined for cortical layers 2/3, as well as migrating basilar pontine neurons and D1 interneurons of the spinal cord. Human proMDGA-1 is 937 amino acids (aa) in length (SwissProt #:Q8NFP4). It is a GPI-linked glycoprotein that contains six consecutive Ig-like domains (aa #24-631), followed by one fibronectin type III domain (aa #640-739), a MAM region (aa #751-918), and a cleavable propeptide (aa #933-955). There are at least three potential variants. One shows a 48 aa substitution for aa #936-955, a second shows a 58 aa substitution for aa #847-955, and a third shows a 51 aa substitution for aa #537-955. Over aa #19-931, human MDGA-1 is 95% aa identical to mouse MDGA-1.

Long Name

MAM Domain Containing Glycosylphosphatidylinositol Anchor 1

Alternate Names

GPIM, MAMDC3

Gene Symbol

MDGA1

Additional MDGA1 Products

Product Documents for MDGA1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MDGA1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...