MDGA2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-93532PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-93532PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MDGA2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MDGA2.

Source: E. coli

Amino Acid Sequence: ALVQLIVQYPPAVEPAFLEIRQGQDRSVTMSCRVLRAYPIRVLTYEWRLGNKLLRTGQFDSQEYTEYAVKSLSNENYGVYNCSIINEAGAGRCSFLVTGKAYAPEFYYDTYNPVWQNRHRVYSYSLQWTQMNPDAV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-93532.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-93532PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MDGA2

MDGA2 (MAM domain-containing glycosylphosphatidylinositol anchor protein 2; also named MAMDC1) is a 130 kDa member of the Ig superfamily of proteins. Human MDGA2 is synthesized as a 956 amino acid (aa) precursor that contains a 25 aa signal sequence, a 906 aa mature chain, and a 25 aa propeptide. The mature chain consists of six Ig-like domains, followed by a MAM domain (aa 746-921) and a GPI anchor. In addition, there are eight potential sites for N-linked glycosylation. Mature human MDGA2 shares 98% aa sequence identity with mature mouse and rat MDGA2. MDGA2 is structurally similar to other IgCAMS, such as the L1 family and axonin 1, which have roles in cell adhesion, migration, and process outgrowth. Northern blot analysis shows MDGA2 expression is limited to the central and peripheral nervous system. Within the brain, moderate expression is observed in the cerebral cortex, the hindbrain, the basilar pons, the neocortex, the hippocampus, the amygdala, olfactory bulb, and selected nuclei of the thalamus. The similarity of MDGA2 to other Ig-containing molecules, and its temporal-spatial patterns of expression within restricted neuronal populations, suggest a role for MDGA2 in regulating neuronal migration, as well as other aspects of neural development, including axon guidance. One study shows that MDGA2 gene is implicated in neuroticism.

Long Name

MAM Domain Containing Glycosylphosphatidylinositol Anchor 2

Alternate Names

MAMDC1

Gene Symbol

MDGA2

Additional MDGA2 Products

Product Documents for MDGA2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MDGA2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.