MFNG Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-14234PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-14234PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all MFNG Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFNG.

Source: E. coli

Amino Acid Sequence: TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLAS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14234.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-14234PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MFNG

MFNG, also known as Beta-1,3-N-acetylglucosaminyltransferase manic fringe, has 2 isoforms, a 321 amino acid isoform that is 36 kDa and a 307 amino acid isoform that is 35 kDa, Golgi apparatus membrane subcellular location, participates in the elongation of O-linked ligands to activate Notch signaling and has fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity. Studies on this protein have shown a relationship with the following diseases and disorders: alagille syndrome, basal cell carcinoma, hepatitis b, psoriasis, hepatitis, and carcinoma. This protein has also been shown to have interactions with NOTCH2, JAG1, JAG2, DLL1, NOTCH1, ITGA3, LHX2, and NOTCH3 in Notch signaling pathway, Pre-NOTCH Expression and Processing, Pre-NOTCH Processing in Golgi, Signal Transduction, Delta-Notch Signaling Pathway, other types of O-glycan biosynthesis, and Development Notch Signaling Pathway.

Long Name

Manic Fringe O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Alternate Names

beta-1,3-N-acetylglucosaminyltransferase manic fringe, EC 2.4.1.222, manic fringe (Drosophila) homolog, manic fringe homolog (Drosophila), MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Gene Symbol

MFNG

Additional MFNG Products

Product Documents for MFNG Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MFNG Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.