MKLP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-56923PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-56923PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all MKLP1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MKLP1.

Source: E. coli

Amino Acid Sequence: APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56923.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-56923PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MKLP1

Using the CHO1 monoclonal antibody, Sellitto and Kuriyama (1988) identified a spindle antigen that was shown by Nislow et al. (1990) to be required for mitotic progression. By using the CHO1 antibody to screen a HeLa cell cDNA library, Nislow et al. (1992) isolated a KNSL5 cDNA, which they called MKLP1 (mitotic kinesin-like protein-1), that encodes this antigen. The N-terminal region of the deduced 961-amino acid protein contains a 350-residue domain that shares 30 to 45% identity with the motor domains of other members of the kinesin superfamily. The C-terminal region shows little identity with other kinesins. A central region contains heptad repeats of hydrophobic residues that may assemble into a coiled-coil structure similar to kinesin and myosin heavy chain proteins. The protein also contains a putative nuclear localization signal and 2 consensus phosphorylation sites characteristic of nuclear proteins.

Alternate Names

kinesin family member 23, kinesin-like 5 (mitotic kinesin-like protein 1), Kinesin-like protein 5, kinesin-like protein KIF23, KNSL5CHO1, mitotic kinesin-like 1, MKLP-1, MKLP1Mitotic kinesin-like protein 1

Gene Symbol

KIF23

Additional MKLP1 Products

Product Documents for MKLP1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MKLP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.