Skip to main content

Recombinant Human MRP6 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00000368-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00000368-P01-10ug
H00000368-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-99 of Human ABCC6

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAPAEPCAGQGVWNQTEPEPAATSLLSLCFLRTAGVWVPPMYLWVLGPIYLLFIHHHGRGYLRMSPLFKAKMVAAIPGSLEPGNVRGRQGTGWNLVKS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human MRP6 GST (N-Term) Protein

SDS-PAGE: Recombinant Human MRP6 GST (N-Term) Protein [H00000368-P01]

SDS-PAGE: Recombinant Human MRP6 GST (N-Term) Protein [H00000368-P01]

SDS-Page: Recombinant Human MRP6 Protein [H00000368-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000368-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: MRP6

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). The encoded protein, a member of the MRP subfamily, is involved in multi-drug resistance. Mutations in this gene cause pseudoxanthoma elasticum. Alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Alternate Names

Anthracycline resistance-associated protein, ARAPXE, ATP-binding cassette, sub-family C (CFTR/MRP), member 6, EST349056, MLP1ABC34, MOATE, MOAT-E, MRP6ATP-binding cassette sub-family C member 6, multidrug resistance-associated protein 6, Multi-specific organic anion transporter E, pseudoxanthoma elasticum, PXE1, URG7

Gene Symbol

ABCC6

Additional MRP6 Products

Product Documents for Recombinant Human MRP6 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human MRP6 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...