MUC12 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82607PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82607PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all MUC12 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MUC12.

Source: E. coli

Amino Acid Sequence: EELFENLAEIVKAKIMNETRTTLLDPDSCRKAILCYSEEDTFVDSSVTPGFDFQEQCTQKAAEGYTQFYYVDVLDGKLACVNKCTKGTKSQMNCNLGTCQLQRSGPRCLCPNTNTHWYWG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82607.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82607PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: MUC12

Human MUC12 (Mucin 12) is a novel mucin of epithelial mucins, which are large, secreted or cell surface glycoproteins involved in epithelial cell protection, adhesion modulation, and signaling. Using differential display on RNA from paired normal colonic mucosa and primary colorectal tumor, MUC12 is identified as one of the 2 partial cDNAs representing novel mucin genes as well as MUC11. They are downregulated in colorectal tumors.The deduced MUC12 protein contains a predicted transmembrane domain, 2 extracellular cysteine-rich EGF-like domains, a coiled-coil region, and a domain consisting of serine-, threonine-, and proline-rich degenerate tandem repeats of 28 amino acids, a structural feature typical of mucins. Human MUC12 shares high sequence homology with MUC3 and MUC4 . Northern blot analysis of 50 different normal tissues detected MUC12 expression in colon, pancreas, prostate, and uterus, with highest expression in colon. The MUC12 transcript is large, estimated to be longer than 12 kb. Expression of MUC12 was downregulated or absent in 6 of 15 (40%) colorectal tumors, as compared with matched normal colonic tissues. MUC12 expression was not detected in any of 6 colorectal cancer cell lines examined. Epitheial mucins are secreted glycoproteins that play roles in cell protection, adhesion modulation and signaling. MUC 12 is a novel mucin gene and may be involved in epithelial cell growth regulation. MUC 12 is down-regulated in colorectal cancers.

Alternate Names

MUC11, MUC-11, MUC-12, mucin 11, mucin 12, cell surface associated, mucin-11, mucin-12

Gene Symbol

MUC12

Additional MUC12 Products

Product Documents for MUC12 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for MUC12 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.