Recombinant Human MYCL1/L-Myc GST (N-Term) Protein

Name: Recombinant Human MYCL1/L-Myc GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004610-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00004610-P01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all MYCL1/L-Myc Proteins and Enzymes »

Product Specifications

Description

Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-206 of Human MYCL1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

48.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human MYCL1/L-Myc GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004610-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: MYCL1/L-Myc

MYCL1 is a member of the MYC family that was isolated from small cell lung carcinoma. Like the other members of the MYC family, MYCL1 is a proto-oncogene transcription factor belonging to the helix-loop-helix basic leucine zipper (HLH bzip) family. With its heterodimeric partners, MYCL1 binds to the DNA consensus site 5'-CACGTG-3'. MYCL1 is implicated in controlling a wide range of cellular processes from cellular proliferation to apoptosis.

Long Name

v-Myc Myelocytomatosis Viral Oncogene Homolog 1, Lung Carcinoma Derived

Alternate Names

L-Myc, LMyc

Gene Symbol

MYCL

Additional MYCL1/L-Myc Products

Product Documents for Recombinant Human MYCL1/L-Myc GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human MYCL1/L-Myc GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews