Myeloperoxidase/MPO Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38922PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38922PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all Myeloperoxidase/MPO Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPO.

Source: E. coli

Amino Acid Sequence: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38922.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38922PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Myeloperoxidase/MPO

FUNCTION: Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity. MPO is an important marker for myeloid cells, from the promyelocyte stage and to the mature forms. CATALYTIC ACTIVITY: Donor + H2O2 = oxidized donor + 2 H2O. CATALYTIC ACTIVITY: Cl- + H2O2 = HOCl + 2 H2O. COFACTOR: Binds 1 calcium ion per heterodimer. COFACTOR: Binds 1 heme B (iron-protoporphyrin IX) group covalently per heterodimer. SUBUNIT: Tetramer of two light chains and two heavy chains. SUBCELLULAR LOCATION: Lysosome. ALTERNATIVE PRODUCTS: 3 named isoforms produced by alternative splicing. DISEASE: Defects in MPO are the cause of myeloperoxidase deficiency (MPD). MPD is an autosomal recessive defect that results in disseminated candidiasis. SIMILARITY: Belongs to the peroxidase family. XPO subfamily.

Alternate Names

MPO

Gene Symbol

MPO

Additional Myeloperoxidase/MPO Products

Product Documents for Myeloperoxidase/MPO Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Myeloperoxidase/MPO Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.