Recombinant Human Myosin 5a GST (N-Term) Protein

Name: Recombinant Human Myosin 5a GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004644-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00004644-Q01

Submit a review

Citations (1)

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Myosin 5a Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1758-1853 of Human Myosin 5a

Source: Wheat Germ (in vitro)

Amino Acid Sequence: KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

36.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Myosin 5a GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00004644-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Myosin 5a

The MYO5 gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The p

Alternate Names

Dilute myosin heavy chain, non-muscle, GS1myosin, heavy polypeptide kinase, MYH12myosin-12, MYO5, Myosin heavy chain 12, myosin V, myosin VA (heavy chain 12, myoxin), myosin VA (heavy polypeptide 12, myoxin), Myosin-12, myosin-Va, Myoxin, MYR12

Gene Symbol

MYO5A

Additional Myosin 5a Products

Product Documents for Recombinant Human Myosin 5a GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Myosin 5a GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews