NAIP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-88596PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-88596PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all NAIP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NAIP.

Source: E. coli

Amino Acid Sequence: KSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDIRVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88596.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-88596PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NAIP

Neuronal apoptosis inhibitor protein (NAIP) was the first human inhibitor of apoptosis protein (IAP) identified and was discovered by its association with the neurodegenerative disorder spinal muscular atrophy. Members of the IAP family contain one to three copies of an approximately 70 amino acid motif termed baculovirus IAP repeat (BIR); these BIRs promote protein-protein interactions with various caspases such as caspase-3, -7, and -9 as well as members of the TRAF family of signal molecules. Unlike other IAPs however, NAIP requires ATP to bind caspase-9 and is not inhibited by the IAP-inhibiting molecule Smac/DIABLO, suggesting that NAIP is unique among the IAPs in its regulation of its activity. Finally, although only one human NAIP protein has been identified, other shorter NAIP mRNA transcripts have been reported.

Long Name

Neuronal Apoptosis Inhibitor Protein

Alternate Names

BIRC1, NLRB1

Gene Symbol

NAIP

Additional NAIP Products

Product Documents for NAIP Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NAIP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.