Skip to main content

NARG1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58078PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-58078PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NARG1.

Source: E. coli

Amino Acid Sequence: RTVLKQEMNRLFGATNPKNFNETFLKRNSDSLPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYRANCHKLFPYALAFMPPGYEEDMKITVN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58078.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58078PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NARG1

NARG1 (NMDA receptor-regulated 1) is also known as NATH (N-acetyltransferase). The NARG1 gene, along with NARG2 and NARG3, was originally identified as a gene regulated by NMDA receptors in developing neurons. The NARG1 gene was found to be a homolog of a yeast N-terminal acetyltransferase that functions in control of the G(0) phase of the cell cycle. NARG1 was also identified as NATH in experiments set out to identify genes differentially expressed in papillary thyroid carcinoma (PTC). The NATH protein has been shown to form a complex with human ARD1 where they function as an acetyltransferase and interact with ribosomal subunits. The ARD1/NATH complex plays an important role in cell survival. Alternative names for NARG1 include protein tubedown-1, Tbdn100, gastric cancer antigen Ga19, and GA19.

Alternate Names

FLJ13340, GA19, Gastric cancer antigen Ga19, N(alpha)-acetyltransferase 15, NatA auxiliary subunit, NARG1, NATHGa19, NMDA receptor-regulated protein 1, N-terminal acetyltransferase, Protein tubedown-1, Tbdn100, TBDN100NatA auxiliary subunit, transcriptional coactivator tubedown-100, tubedown-1

Gene Symbol

NAA15

Additional NARG1 Products

Product Documents for NARG1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NARG1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...