Skip to main content

Nectin-4/PVRL4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82829PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-82829PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PVRL4.

Source: E. coli

Amino Acid Sequence: KLPCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82829.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82829PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Nectin-4

PVRL4, also known as Poliovirus receptor-related protein 4, is a 510 amino acid protein that is 55 kDa, predominantly expressed in placenta and breast carcinoma, is a single-pass type I membrane protein involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with PVRL2/nectin-1, and oes not act as receptor for alpha-herpesvirus entry into cells. Disease research is being performed in relation to this protein and ectodermal dysplasia, syndactyly, ectodermal dysplasia-syndactyly syndrome 1, measles, ovarian cancer, breast carcinoma, lung cancer, and carcinoma. The PVRL4 protein has shown an interaction with PVRL1, MLLT4, PICK1, TIGIT, PARD3, PVRL3, and PVRL2 in Adherens junctions interactions, Nectin/Necl trans heterodimerization, Cell junction organization, Cell-Cell communication, Cell-cell junction organization, Sertoli-Sertoli Cell Junction Dynamics, and Epithelial Adherens Junctions pathways.

Long Name

Poliovirus Receptor Related 4

Alternate Names

LNIR, Nectin4, PRR4, PVRL4

Gene Symbol

NECTIN4

Additional Nectin-4 Products

Product Documents for Nectin-4/PVRL4 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Nectin-4/PVRL4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...