NEK1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82883PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-82883PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all NEK1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEK1.

Source: E. coli

Amino Acid Sequence: VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82883.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82883PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NEK1

Belonging to the NEK Ser/Thr protein kinase family, NEK1 plays an important role in the cell by responding to DNA damage. Molecular functions for NEK1 include protein serine/threonine kinase activity, protein tyrosine kinase activity, protein binding and ATP binding. More specifically, NEK1 is involved in cell cycle regulation, and the protein encoded by this gene is a serine/threonine kinase which is found in a centrosomal complex with FEZ1. Additionally, NEK1 also appears to possess tyrosine kinase activity and is involved in the control of meiosis and cilium assembly. NEK1 is known to interact with FEZ1, FEZ2, KIF3A, TSC2 and MRE11A. Common diseases for NEK1 include adenocarcinoma, cancer, short rib-polydactyly syndrome II and epithelial neoplasia.

Alternate Names

DKFZp686D06121, DKFZp686K12169, EC 2.7.11, EC 2.7.11.1, KIAA1901MGC138800, Never in mitosis A-related kinase 1, NIMA (never in mitosis gene a)-related kinase 1, NimA-related protein kinase 1, NY-REN-55, protein-serine/threonine kinase, Renal carcinoma antigen NY-REN-55, serine/threonine-protein kinase Nek1, SRPS2

Gene Symbol

NEK1

Additional NEK1 Products

Product Documents for NEK1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NEK1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.