Skip to main content

Netrin-1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-31640PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-31640PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NTN1.

Source: E. coli

Amino Acid Sequence: GDWWKFTVNIISVYKQGTSRIRRGDQSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31640.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-31640PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Netrin-1

Semaphorins, neuropilins and netrins are among a number of molecules and their receptors that regulate the developing nervous system to guide the development of neural circuits.1 Although first identified as axon guidance cues,2,3 it is now apparent that many of these same factors are not limited to the guidance of growing axons, but have roles in a range of processes from the guidance of cell migration to the regulation of the immune response, angiogenesis, lung branching morphogenesis, nervous system regeneration, and cancer.4-9 The semaphorins make up the largest family of axon guidance cues. They are characterized by the presence of an approximately 500 amino acid N-terminal semaphorin (Sema) domain. Semaphorins function mainly as chemorepellents that direct axons away from tissues.3 Semaphorin 3A (Sema3A) has been shown to be repellent to cortical axons and to inhibit axon branching.10 The transmembrane protein semaphorin 6A has been shown to repel embryonic sympathetic axons.11 The actions of the various semaphorins are not always similar. Semaphorin 3A has been found to inhibit tumor development whereas semaphorin 6A may contribute to tumor progression.9 Neuropilins are the ligand binding moieties in the class 3 Semaphorin receptor complexes that subsequently activate signaling through associated plexins. Two types have been identified so far: Neuropilin-1 (Npn-1) and Neuropilin-2 (Npn-2) receptors. At the amino acid sequence level, Npn-1 and Npn-2 share 44% identity. Npn-1 and Npn-2 show different expression patterns in developing neurons of the central and peripheral nervous systems, and show different binding specificities for different members of he semaphorin family. Both also function as receptors for some forms of vascular endothelial growth factor (VEGF).12 Netrins are a family of laminin-related small proteins that are involved in axon guidance and eurite outgrowth. Netrin-1 has been shown to attract cortical growth cones and promote axon branching.10 Netrin-4 (first named b-netrin) was found to promote neurite elongation from olfactory bulb explants.

Alternate Names

Netrin1, NTN1

Gene Symbol

NTN1

Additional Netrin-1 Products

Product Documents for Netrin-1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Netrin-1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...