Skip to main content

Netrin-2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-30487PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP2-30487PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NTN3.

Source: E. coli

Amino Acid Sequence: CVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30487.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-30487PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Netrin-2

Netrins have been identified as midline-derived chemoattractants that guide axons to the midline during development. Netrins are antagonized by Slit and Robo proteins which compete for DCC (deleted in colorectal cancer) receptor binding. Netrins also have axon repulsion effects when interacting with the UNC5 (uncoordinated-5) receptor family, either alone or with DCC receptors. Netrins are a laminin-related family of matrix-binding secreted proteins containing an N-terminal laminin gamma-chain-related globular domain (domain VI), three laminin EGF-like repeats, and a C-terminal heparin-binding domain.

Netrin-G1a and Netrin-G2a are members of the GPI-linked Netrin subfamily distantly related to classic Netrins. Membrane-bound G-type Netrins are suggested to promote neurite outgrowth and perhaps impact neuronal plasticity. G-type Netrins are found only in vertebrates. Netrin-G1a and Netrin-G2a contain an N-terminal laminin globular domain (domain VI) followed by 3 laminin EGF-like repeats, and a C-domain with a hydrophobic signal for glycosylphosphatidylinositol (GPI) lipid linkage. The Netrin-G2a molecule also contains a C-terminal heparin binding site.

Alternate Names

Netrin2

Gene Symbol

NTN3

Additional Netrin-2 Products

Product Documents for Netrin-2 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Netrin-2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...