NG2/MCSP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89682PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89682PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all NG2/MCSP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSPG4.

Source: E. coli

Amino Acid Sequence: ILYEHEMPPEPFWEAHDTLELQLSSPPARDVAATLAVAVSFEAACPQRPSHLWKNKGLWVPEGQRARITVAALDASNLLASVPSPQRSEHDVLFQVTQFPSRGQLLVSEEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89682.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89682PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NG2/MCSP

Proteoglycans (PGs) are a family of proteins composed of different polypeptide chains containing glycosaminoglycan (GAG) modifications. They vary in their cellular locations and have diverse structure and functions. NG2 is a proteoglycan found in the nervous system, comprising a large integral membrane PG with a core protein of 300 kDa and at least one covalently attached chondroitin sulfate (CS) GAG chain. In the CNS this protein is expressed mainly on the surfaces of developing and adult oligodendrocyte precursor cells, but is also associated with developing chondrocytes, cardiomyocytes, pericytes and several human tumours.

Long Name

Chondroitin Sulfate Proteoglycan NG2/Melanoma Associated Chondroitin Sulfate Proteoglycan

Alternate Names

AN2, CSPG4, HMW-MAA, MCSP, MCSPG, MEL-CSPG

Gene Symbol

CSPG4

Additional NG2/MCSP Products

Product Documents for NG2/MCSP Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NG2/MCSP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.