NGFRAP1/BEX3/NADE Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89987PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-89987PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all NGFRAP1/BEX3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NGFRAP1.

Source: E. coli

Amino Acid Sequence: NEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89987.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89987PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NGFRAP1/BEX3

The p75 neurotrophin receptor (p75NTR) is a member of the tumor necrosis receptor superfamily and can mediate cell death and cell survival in response to nerve growth factor (NGF). The p75NTR-associated cell death executor (NADE) mediates apoptosis by interacting with the cell death domain of p75NTR following the binding of NGF by p75NTR. Recent studies have shown that NADE also interacts with second mitochondria-derived activator of caspase (Smac). Coexpression of NADE and Smac promotes TRAIL-induced apoptosis and inhibits XIAP-mediated Smac ubiquitization. It has been suggested that it is this interaction between NADE and Smac that allows apoptosis to proceed. Finally, although initially discovered as an mRNA expressed in ovarian granulosa cells, NADE has been suggested to play a role in the neuronal death seen in epileptic brain damage.

Long Name

Nerve Growth Factor Receptor Associated Protein 1

Alternate Names

BEX3, HGR74, NADE

Gene Symbol

BEX3

Additional NGFRAP1/BEX3 Products

Product Documents for NGFRAP1/BEX3/NADE Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NGFRAP1/BEX3/NADE Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.