Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein
Novus Biologicals, part of Bio-Techne | Catalog # H00001134-Q01
Key Product Details
Source
Wheat germ
Tag
GST (N-Term)
Conjugate
Unconjugated
Applications
ELISA, Flow Cytometry, Affinity Purification, Microarray, SDS-PAGE, Western Blot
Product Specifications
Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 146-231 of Human Nicotinic Acetylcholine R alpha 1/CHRNA1
Source: Wheat Germ (in vitro)
Amino Acid Sequence: SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP
Purity
>80% by SDS-PAGE and Coomassie blue staining
Predicted Molecular Mass
35.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Activity
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Application Notes
Use in FLOW cytometry and blocking/ neutralizing reported in scientific literature ( PMID 25050620)
Protein / Peptide Type
Recombinant Protein
Scientific Data Images
![SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein [H00001134-Q01]](https://resources.bio-techne.com/images/products/qc_test-H00001134-Q01-1.jpg "SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein [H00001134-Q01]")
SDS-PAGE: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein [H00001134-Q01]
SDS-Page: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 Protein [H00001134-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.Formulation, Preparation and Storage
H00001134-Q01
| Preparation Method | in vitro wheat germ expression system |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Concentration | Please see the vial label for concentration. If unlisted please contact technical services. |
| Shipping | The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below. |
| Stability & Storage | Store at -80C. Avoid freeze-thaw cycles. |
Background: Nicotinic Acetylcholine R alpha 1/CHRNA1
Long Name
Nicotinic Acetylcholine Receptor alpha 1
Alternate Names
ACHRA, CHRNA1, CMS2A, FCCMS, nAChR alpha 1, nAchRa1, Nicotinic Acetylcholine Ra1, SCCMS
Gene Symbol
CHRNA1
Additional Nicotinic Acetylcholine R alpha 1/CHRNA1 Products
- All Products for Nicotinic Acetylcholine R alpha 1/CHRNA1
- Nicotinic Acetylcholine R alpha 1/CHRNA1 cDNA Clones
- Nicotinic Acetylcholine R alpha 1/CHRNA1 ELISA Kits
- Nicotinic Acetylcholine R alpha 1/CHRNA1 Lysates
- Nicotinic Acetylcholine R alpha 1/CHRNA1 Primary Antibodies
- Nicotinic Acetylcholine R alpha 1/CHRNA1 Proteins and Enzymes
Product Specific Notices
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.
Loading...
Loading...
Loading...
Loading...