NLRP2/NALP2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-85553PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-85553PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all NLRP2/NALP2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NLRP2.

Source: E. coli

Amino Acid Sequence: EVDKADGKQLVEILTTHCDSYWVEMASLQVFEKMHRMDLSERAKDEVREAALKSFNKRKPLSLGITRKERPPLDVDEMLERFKTEAQAFTETKGNVI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85553.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-85553PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NLRP2/NALP2

NLRP2/NALP2, aka PAN1 and PYPAF2, belongs to a cytoplasmic proteins family containing a NACHT domain, leucine rich repeat (NLR) and N-terminal pyrin-containing domain (PYD). As an intracellular pathogen-recognition receptors (PRRs), NLRP2/NALP2 is a 1062 amino acid protein associated in cell responses to apoptotic and inflammatory stimuli. PRRs are key components of immune systems involving in an innate effector mechanisms and activation of adaptive immunity. By interacting with ASC in addition to CARD8 and caspase 1, NLRP2/NALP2 forms an inflammasome functioning as a modulator of NF-kB and procaspase-1 activation in macrophages. Similar to TLRs, activation of the inflammasome by NLRs occurs through the recognition of pathogen-associated molecular patterns (PAMPs) through their LRR domains. NLRP2/NALP2 expressions varies in several human tumor cell lines though the highest were found in MDA-MB-435 and MCF-7 breast cancer, UACC62 melanoma, and Caco2 colon cancer cells.

Long Name

NLR Family, Pyrin Domain Containing 2

Alternate Names

NALP2, NBS1, PAN1, PYPAF2

Gene Symbol

NLRP2

Additional NLRP2/NALP2 Products

Product Documents for NLRP2/NALP2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NLRP2/NALP2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.