Skip to main content

NUFIP1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-82515PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-82515PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NUFIP1.

Source: E. coli

Amino Acid Sequence: SYYPRKYDAKFTDFSLPPSRKQKKKKRKEPVFHFFCDTCDRGFKNQEKYDKHMSEHTKCPELDCSFTAHEKIVQFHWRNM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82515.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-82515PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NUFIP1

NUFIP1, also known as Nuclear fragile X mental retardation-interacting protein 1, is a 495 amino acid protein that is 56 kDa, binds RNA, contains a C2H2 zinc finger motif and a nuclear localization signal, it is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. Current research is being performed on several diseases and disorders including intellectual disability, neuronitis, microcephaly, and prostatitis. This protein has been shown to have interactions with YWHAZ, BRCA1, CCNT1, RUVBL2, FMR1, and over 30 other proteins in box C/D snoRNP assembly, RNA processing, and positive regulation of transcription from RNA polymerase II promoter pathways.

Alternate Names

bA540M5.1, nuclear fragile X mental retardation protein interacting protein 1, nuclear fragile X mental retardation protein-interacting protein 1, nuclear fragile X mental retardation-interacting protein 1, NUFIP, NUFIPNuclear FMRP-interacting protein 1

Gene Symbol

NUFIP1

Additional NUFIP1 Products

Product Documents for NUFIP1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NUFIP1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...