Skip to main content

NXF3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89471PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89471PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NXF3.

Source: E. coli

Amino Acid Sequence: NPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHEENIPTVMSAGEMDKWKGIEPGEKCADRSPVCTTFSDTSSNINSILELFPKLLCLDGQQSPRATLCGTEAHKRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89471.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89471PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: NXF3

Nuclear export factor (NXF) proteins belong to an evolutionarily conserved family of proteins which are characterized by a leucine-rich-repeat domain(LRR) followed by a region known as the Nuclear Transport Factor 2 (NTF2)-like domain. The NXF family includes TAP1 (NXF1) and NXF2-5. TAP1 mediates the export of constitutive transport element (CTE)-containing simian type D retroviral RNAs through direct binding to the CTE. NXF2 binds RNA and localizes to the nuclear envelope, where it exhibits RNA export activity. NXF3 does not bind RNA nor localize to the nuclear rim, and NXF3 does not exhibit RNA export activity. NXF5 binds RNA and localizes in the form of granules in the cell body and neurites of mature hippocampal neurons. TAP1, NXF2 and NXF5 form heterodimers with RNA nuclear export-associated protein p15 (NXT). The human NXF gene cluster maps to Xcen-NXF5-NXF2-NXF4-NXF3-Xqter.

Alternate Names

nuclear RNA export factor 3, TAPL3, TAPL-3, TAP-like protein 3

Gene Symbol

NXF3

Additional NXF3 Products

Product Documents for NXF3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for NXF3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...