p15INK4b/CDKN2B Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-38023PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-38023PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all p15INK4b/CDKN2B Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDKN2B.

Source: E. coli

Amino Acid Sequence: MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38023.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-38023PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: p15INK4b/CDKN2B

The normal progression of cells through the cell cycle is under the control of the cyclin dependent protein kinases Cdk4 and Cdk6 which are subject to inhibition by the mitotic inhibitory protein, p16. An isolated member of the p16 family has been designated p15. p15 expression is upregulated approximately 30-fold in TGFbeta-treated human keratinocytes, suggesting that p15 may act as an effector of TGFbeta-mediated cell cycle arrest. The gene encoding p15 has been mapped to chromosome 9p21 at a position adjacent to the p16 gene at a site of frequent chromosomal abnormality in human tumors. It has been suggested that p15 may function as an effector of TGFbeta-mediated cell cycle arrest through inhibition of Cdk4 and Cdk6 kinases.

Long Name

p15 Cyclin Dependent Kinase 4 Inhibitor 2B

Alternate Names

CDKN2B, MTS2

Gene Symbol

CDKN2B

Additional p15INK4b/CDKN2B Products

Product Documents for p15INK4b/CDKN2B Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for p15INK4b/CDKN2B Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.