PDGF-C Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83935PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83935PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all PDGF-C Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDGFC.

Source: E. coli

Amino Acid Sequence: LDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVLQLRPKTGVRGLHKSLTDVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83935.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83935PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PDGF-C

PDGFC, also known as Platelet-derived growth factor C, has 3 isoforms, a 345 amino acid isoform that is 39 kDa, a 282 amino acid isoform that is 32 kDa and a 167 amino acid isoform that is 19 kDa, expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract and retinal pigment epithelia; plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis, wound healing, represents potent mitogen for cells of mesenchymal origin, induces macrophage recruitment, increased interstitial pressure, and blood vessel maturation during angiogenesis, can initiate events that lead to a mesangial proliferative glomerulonephritis, including influx of monocytes and macrophages and production of extracellular matrix. This protein is being studied for its involvement in mesangial proliferative glomerulonephritis, proliferative glomerulonephritis, glomerulonephritis, brain cancer, prostate carcinoma, nephropathy, prostatitis, prostate cancer, atherosclerosis, retinitis, melanoma, and carcinoma. The protein has been linked to the cytoskeleton remodeling role of PDGFs in cell migration, development PDGF signaling via MAPK cascades, release of novel PDGFs as latent factors, signal transduction, signaling by PD, focal adhesion, gap junction, regulation of actin cytoskeleton, prostate cancer, and melanoma GF pathways where it interacts with PDGFRB, PDGFRA, PLAT, PLAU, PLAUR, EGFR, ERBB2, FGFR1, FLT1, and FLT4 proteins.

Long Name

Platelet-derived Growth Factor C

Alternate Names

PDGFC

Gene Symbol

PDGFC

Additional PDGF-C Products

Product Documents for PDGF-C Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PDGF-C Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.