Skip to main content

PEMT Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87297PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-87297PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PEMT.

Source: E. coli

Amino Acid Sequence: GFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87297.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87297PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PEMT

PEMT also known as Phosphatidylethanolamine N-methyltransferase, has 3 isoforms, a 199 amino acid isoform that is 22 kDa, a 236 amino acid that is 26 kDa, and 232 amino acid isoform that is 25 kDa, converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver and localizes to the endoplasmic reticulum and mitochondria-associated membranes. This protein is being studied for its involvement in ceroid lipofuscinosis, neuronal ceroid-lipofuscinosis, smith-magenis syndrome, spina bifida, orofacial cleft, whiplash, fatty liver disease, liver disease, cystic fibrosis, hepatocellular carcinoma, Alzheimer's disease, gigantism, breast cancer, liver cancer, homocysteine, fibrosis, alcoholism, endometriosis, gastric cancer, and infertility. The protein has been linked to the glycerophospholipid biosynthesis, metabolism, phospholipid metabolism, synthesis of PC, metabolism of lipids and lipoproteins, acetylcholine synthesis, and acetylcholine synthesis pathways where it interacts with CALM1, CALM2, CALM3, ALG5, ALG6, ALG8, EMC3, FEN1, and over 180 other proteins.

Alternate Names

EC 2.1.1.17, PEMPTMGC2483, PEMT2PEAMT, phosphatidylethanolamine N-methyltransferase, PNMT

Gene Symbol

PEMT

Additional PEMT Products

Product Documents for PEMT Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PEMT Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...