PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-83989PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-83989PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all PHD4/HIF Prolyl Hydroxylase 4 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P4HTM.

Source: E. coli

Amino Acid Sequence: KADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLYQGEGAHHIMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRQVSPNWGLPSILRPGTP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83989.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-83989PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PHD4/HIF Prolyl Hydroxylase 4

Prolyl hydroxylase 4 is a prolyl hydroxylase that modifies HIF-alpha. Classic prolyl hydroxylases are found in the endoplasmic reticulum and modify collagen, whereas HIF is an intracellular protein and the prolyl hydroxylase sites do not resemble those modifying collagen. HIF is a transcriptional complex that plays a critical role in oxygen homeostasis. Prolyl hydroxylase is an essential component of the pathway through which cells sense oxygen. In the presence of oxygen, prolyl hydroxylases convert specific prolyl residues in HIF-alpha to hydroxyproline, leading to HIF-alpha destruction. Low oxygen levels, sensed at the cellular level, cause the HIF conversion to be reduced so that HIF is stable and there is increased angiogenesis. Prolyl hydroxylase 4, specifically, catalyzes the post-translational formation of 4-hydroxyproline in HIF alpha proteins. It may function as a cellular oxygen sensor and, under normoxic conditions, may targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitylation complex.

Alternate Names

EC 1.14.11.-, EGLN4, HIFPH4, HIF-PH4, HIF-prolyl hydroxylase 4, HPH-4, hypoxia-inducible factor prolyl 4-hydroxylase, Hypoxia-inducible factor prolyl hydroxylase 4, P4H with transmembrane domain, P4H-TMFLJ20262, PH-4, PH4 hypoxia inducible factor prolyl 4 hydroxylase, PHD4, proline 4-hydroxylase, prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum), Prolyl hydroxlase domain-containing 4, transmembrane prolyl 4-hydroxylase

Gene Symbol

P4HTM

Additional PHD4/HIF Prolyl Hydroxylase 4 Products

Product Documents for PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PHD4/HIF Prolyl Hydroxylase 4 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.