PIGA Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-13760PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-13760PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PIGA Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PIGA.

Source: E. coli

Amino Acid Sequence: FADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQKYPDLNFIIGGEGPKRII

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13760.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-13760PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PIGA

PIGA, also known as Phosphatidylinositol N-acetylglucosaminyltransferase subunit A, has three isoforms that are produced by alternative splicing. Isoform 1, the canonical sequence, is 484 amino acids long and 54 kDa. Isoform 2 and 3 are both shorter isoforms, at 315 and 250 amino acids, respectively. PIGA is a critical player in the synthesis of N-acetylglucosaminyl-phosphatidylinositol, which is the first intermediate in the biosynthesis of GPI anchors. Current research on PIGA is being conducted in relation to several diseases and disorders including Paroxysmal nocturnal hemoglobinuria, which may be caused by mutations in the PIGA gene. Other diseases and disorders related to PIGA include multiple congenital anomalies-hypotonia-seizures syndrome type 2, anemia, Burkitt's lymphoma, hepatic vein thrombosis and Myelodysplastic syndrome. PIGA has been shown to have interactions with DPM2, PIGQ, PIGH, PYURF and PIGP in pathways such as GPI anchor biosynthesis and metabolic pathways.

Alternate Names

class A GlcNAc-inositol phospholipid assembly protein, EC 2.4.1.198, GlcNAc-PI synthesis protein, GPI anchor biosynthesis, GPI3, phosphatidylinositol glycan anchor biosynthesis, class A, phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria), phosphatidylinositol N-acetylglucosaminyltransferase subunit A, Phosphatidylinositol-glycan biosynthesis class A protein, phosphatidylinositol-glycan biosynthesis, class A protein, PIG-A

Gene Symbol

PIGA

Additional PIGA Products

Product Documents for PIGA Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PIGA Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.