Skip to main content

PITPNC1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-80847PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-80847PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PITPNC1.

Source: E. coli

Amino Acid Sequence: FAWVDEWYDMTMDEVREFERATQGATNKKIGIFPPAISISSIPLLPSSVRSAPSSAPSTPLSTDAPEFLSVPKDRPRKKSAPETLTLPDPEKKATLNLPGMHSSDKPCR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80847.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-80847PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PITPNC1

PITPNC1, also known as Cytoplasmic phosphatidylinositol transfer protein 1, has a 332 amino acid long isoform that is 38 kDa and a short 268 amino acid isoform that is 32 kDa, with cytoplasmatic subcellular location, ubiquitously expressed, mediates the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity, able to transfer phosphatidylinositol in vitro. This protein is currently being studied for research on retinal degeneration and retinitis. Interactions with the PITPNC1 protein have been shown to involve AGTRAP and UBC in transport and signal transduction processes.

Alternate Names

cytoplasmic phosphatidylinositol transfer protein 1, Mammalian rdgB homolog beta, M-rdgB beta, mrdgBbeta, phosphatidylinositol transfer protein, cytoplasmic 1, RDGBB, RDGBB1, RdgBbeta, RDGB-BETA, retinal degeneration B beta 1, Retinal degeneration B homolog beta

Gene Symbol

PITPNC1

Additional PITPNC1 Products

Product Documents for PITPNC1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PITPNC1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...