PKC delta Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-90351PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-90351PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PKC delta Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKCD.

Source: E. coli

Amino Acid Sequence: ANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90351.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-90351PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PKC delta

PKC-delta has a biological activity which is closely related to Pkc1, and PKC-delta activates the Pkc1-mediated pathway through an activation of the Bck1 kinase. PKC-delta appears to play a critical role in growth control of yeast and mammalian cells. Suppression experiments suggest that PKC-delta desensitizes the pathway by regulating an aspect of G protein function (1). PKC-delta phosphorylates hRad9 in vitro and in cells exposed to genotoxic agents. It has been shown that PKC-delta is required for binding of hRad9 to Bcl-2. In concert with these results, inhibition of PKC-delta attenuates Rad9-mediated apoptosis. These findings demonstrate that PKC-delta is responsible for the regulation of Rad9 in the Hus1-Rad1 complex and in the apoptotic response to DNA damage (2). It has been reported a mechanism for the regulation of peripheral B-cell survival by serine/threonine protein kinase Cdelta (PKC-delta): spontaneous death of resting B cells is regulated by nuclear localization of PKC-delta that contributes to phosphorylation of histone H2B at serine 14 (S14-H2B) (3).

Long Name

Protein Kinase C delta

Alternate Names

PRKCD

Gene Symbol

PRKCD

Additional PKC delta Products

Product Documents for PKC delta Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PKC delta Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.