PLC-beta 3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32026PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32026PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all PLC-beta 3 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCB3.

Source: E. coli

Amino Acid Sequence: RILVKNKKRHRPSAGGPDSAGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGDEGLNRGPYVLGPADR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32026.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32026PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PLC-beta 3

Phosphoinositide-specific phospholipase C (PLC) plays a critical role in the initiation of receptor mediated signal transduction through the generation of the two second messengers, inositol 1, 4, 5-triphosphate and diacylglycerol from phosphatidylinositol 4, 5 bisphosphate. A total of eight mammalian PLC isozymes have been described (PLC beta1, PLC beta2, PLC beta3, PLC beta4, PLC gamma1, PLC gamma2, PLC delta1 and PLC delta2) with molecular weights ranging from 85 to 150 kDa. The gamma-type enzymes are unique in that they contain SH2 and SH3 domains. Moreover, the two gamma-type enzymes, but not the beta and delta isozymes, are subject to activation by a number of protein tyrosine kinases which associate with their SH2 domains and induce their activation by phosphoryation. In contrast, activation of PLC beta1, PLC beta2 and PLC beta3 is mediated by the alpha subunits of the Gq class of heterotrimeric G proteins and by certain betagamma G protein subunits. The regulatory mechanisms for PLC delta1 and PLC delta2 are as yet not resolved.

Long Name

Phospholipase C beta 3

Alternate Names

PLCB3, PLCbeta 3

Gene Symbol

PLCB3

Additional PLC-beta 3 Products

Product Documents for PLC-beta 3 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PLC-beta 3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.