PREB Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-87057PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-87057PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all PREB Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PREB.

Source: E. coli

Amino Acid Sequence: REAHGIVVTDVAFLPEKGRGPELLGSHETALFSVAVDSRCQLHLLPSRRSVP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87057.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-87057PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: PREB

Prolactin (PRL) expression in the pituitary is limited to specific cells. Pit-1 is a pituitary specific transcription factor that plays an important role in PRL expression, both in mature organism and during development. The PRL promoter contains numerous Pit-1 binding sites and these sites have been implicated in both basal level and kinase-mediated gene expression. The most proximal of these binding sites, termed 1P, has been shown to direct a response to numerous signals, such as cAMP and various G-proteins. A novel protein, termed PREB (prolactin regulatory element binding protein), has been recently identified that regulates PRL gene expression through the 1P site, though it contains no discernable DNA-binding motif. Recent studies suggest that PREB is encoded by a single-copy gene in both mice and humans and exhibits nuclear accumulation in pituitary cells. Evidence suggests that PREB is a novel transcription factor that assists in PRL expression whether alone, or in concert with Pit-1.

Long Name

Prolactin Regulatory Element Binding

Alternate Names

MGC3467, SEC12

Gene Symbol

PREB

Additional PREB Products

Product Documents for PREB Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for PREB Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.