Skip to main content

Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00005241-Q01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00005241-Q01-10ug
H00005241-Q01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-110 of Human Progesterone R/NR3C3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein

SDS-PAGE: Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein [H00005241-Q01]

SDS-PAGE: Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein [H00005241-Q01]

SDS-Page: Progesterone R/NR3C3 Partial Recombinant Protein [H00005241-Q01]

Formulation, Preparation and Storage

H00005241-Q01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: Progesterone R/NR3C3

The human Progesterone Receptor (PgR) is a member of the steroid family of nuclear receptors. PgR is found as a 120 kDa protein (Form B) or a 94 kDa protein (Form A) due to the use of alternative translation initiation sites. In its inactive state, PgR forms a multiprotein complex which includes heat shock proteins and immunophins. Upon binding of progesterone hormone to its receptor, there is a conformational change that allows dimerization and binding of the receptor to progesterone response elements (PRE) sequences, resulting in activated transcription.

Long Name

Progesterone Receptor

Alternate Names

NR3C3, PGR, ProgesteroneR

Gene Symbol

PGR

Additional Progesterone R/NR3C3 Products

Product Documents for Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human Progesterone R/NR3C3 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...