Recombinant Human CD44v6 His-tag Protein, CF

R&D Systems, part of Bio-Techne | Catalog # 11237-CD

R&D Systems, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
11237-CD-050
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

CHO

Accession #

NP_001001391.1

Conjugate

Unconjugated

Applications

Bioactivity

View all CD44 Proteins and Enzymes »

Product Specifications

Source

Chinese Hamster Ovary cell line, CHO-derived human CD44 protein
Human CD44v6
(Gln21-Thr222)
IQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAG
(Asp224-Trp269)
Accession # NP_001001391.1		 6-His tag
N-terminus C-terminus

Purity

>95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.

Endotoxin Level

<0.10 EU per 1 μg of the protein by the LAL method.

N-terminal Sequence Analysis

Gln21

Predicted Molecular Mass

33 kDa

SDS-PAGE

53-76 kDa, under reducing conditions.

Activity

Measured by its binding ability in a functional ELISA.
When Recombinant Human CD44v6 His-tag (Catalog # 11237-CD) is immobilized at 0.500 μg/mL (100 μL/well), Recombinant Human LSECtin/CLEC4G  (Catalog # 2947-CL) binds with an ED50 of 3.00-15.0 ng/mL.

Scientific Data Images for Recombinant Human CD44v6 His-tag Protein, CF

Recombinant Human CD44v6 His-tag Protein Binding Activity.

Measured by its binding ability in a functional ELISA. When Recombinant Human CD44v6 His-tag Protein (Catalog # 11237-CD) is immobilized at 0.50 ug/mL (100 uL/well), Recombinant Human LSECtin/CLEC4G Protein (2947-CL) binds with an ED50 of 3.00-15.0 ng/mL.

Recombinant Human CD44v6 His-tag Protein SDS-PAGE.

2 μg/lane of Recombinant Human CD44v6 His-tag Protein (Catalog # 11237-CD) was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by Coomassie® Blue staining, showing bands at 53-76 kDa.

Formulation, Preparation and Storage

11237-CD
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.
Reconstitution Reconstitute at 500 μg/mL in PBS.
Shipping The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
  • 12 months from date of receipt, -20 to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.
  • 3 months, -20 to -70 °C under sterile conditions after reconstitution.

Background: CD44

CD44 is a ubiquitously expressed protein that is the major receptor for hyaluronan and exerts control over cell growth and migration (1-3). Human CD44 has a 20 amino acid (aa) signal sequence, an extracellular domain (ECD) with a 100 aa hyaluronan-binding disulfide-stabilized link region and a 325-530 aa stem region, a 21 aa transmembrane domain, and a 72 aa cytoplasmic domain. CD44 transcripts undergo complex alternative splicing, and, within the stem, ten variably spliced exons (v1-10 corresponding to exons 6-15; although human CD44 lacks v1/exon 6) produce multiple protein isoforms (1-4). The standard or hematopoietic form, CD44H, does not include the variable segments (1-4). Cancer aggressiveness and T cell activation have been correlated with expression of specific isoforms (1, 4, 5). Human CD44v6 contains exon 11 (v6) and is involved in many biological processes including cell growth, apoptosis, and metastasis (6-7). With variable N- and O-glycosylation and splicing within the stalk, CD44 can range from 80 to 200 kDa (1). Within the N-terminal invariant portion of the ECD (aa 21-222), human CD44 shares 76%, 76%, 86%, 83% and 79% identity with corresponding mouse, rat, equine, canine and bovine CD44, respectively. The many reported functions of CD44 fall within three categories (1). First, CD44 binds hyaluronan and other ligands within the extracellular matrix and can function as a "platform" for growth factors and metalloproteinases. Second, CD44 can function as a co-receptor that modifies activity of receptors including MET and the ERBB family of tyrosine kinases. Third, the CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form (8) or may be cleaved at multiple sites by either membrane-type matrix metalloproteinases, or ADAM proteases to produce soluble ectodomains (9-10). The cellular portion may then undergo gamma secretase-dependent intramembrane cleavage to form an A beta-like transmembrane portion and a cytoplasmic signaling portion that affects gene expression (11-12). These cleavage events are thought to promote metastasis by enhancing tumor cell motility and growth (1, 8). CD44v6 plays an important role in colorectal cancer progression involving in cell colonization, invasion, and metastasis and is considered a functional cancer biomarker (7).

References

  1. Ponta, H. et al. (2003) Nat. Rev. Mol. Cell Biol. 4:33.
  2. Screaton, G.R. et al. (1992) Proc. Natl. Acad. Sci. USA 89:12160.
  3. Screaton, G.R. et al. (1993) J. Biol. Chem. 268:12235.
  4. Lynch, K.W. (2004) Nat. Rev. Immunol. 4:931.
  5. Todaro, M. et al. (2014) Cell stem cell 14:342.
  6. Vizoso, F.J. et al. (2004) J. Cancer Res. Clin. Oncol. 130:679.
  7. Ma, L. et al. (2019) Cell Death Dis. 10:30.
  8. Yu, Q. and B.P. Toole (1996) J. Biol. Chem. 271:20603.
  9. Nagano, O. and H. Saya (2004) Cancer Sci. 95:930.
  10. Nakamura, H. et al. (2004) Cancer Res. 64:876.
  11. Murakami, D. et al. (2003) Oncogene 22:1511.
  12. Lammich, S. et al. (2002) J. Biol. Chem. 277:44754.

Alternate Names

CD44, ECMR-III, HCAM, HCELL, LHR, MDU2, MDU3, MIC4, MUTCH-I, Pgp1

Entrez Gene IDs

960 (Human); 12505 (Mouse); 25406 (Rat); 100126860 (Porcine)

Gene Symbol

CD44

UniProt

NP_001001391.1

Additional CD44 Products

Product Documents for Recombinant Human CD44v6 His-tag Protein, CF

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Note: Certificate of Analysis not available for kit components.

Download SDS

Product Specific Notices for Recombinant Human CD44v6 His-tag Protein, CF

For research use only

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.