RFXAP Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-58217PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-58217PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all RFXAP Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RFXAP.

Source: E. coli

Amino Acid Sequence: NVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58217.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-58217PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RFXAP

The identification of transacting factors controlling major histocompatibility complex (MHC) class II gene transcription via the proximal enhancer of the promoter has been greatly facilitated by a genetic approach, namely, the analysis of cell lines that are characterized by regulatory defects abolishing transcription of these genes (Mach et al., 1996). Most of these MHC class II regulatory mutants are cell lines derived from patients suffering from MHC class II deficiency, also referred to as the bare lymphocyte syndrome type II, a rare autosomal recessive disorder characterized by the lack of constitutive and inducible MHC class II expression in all cell types and tissues. The genetic lesions responsible for this lack of expression lie not in MHC class II genes themselves, but in transacting regulatory genes required for their transcription (Mach et al., 1996). Durand et al. (1997) noted that at least 3 different complementation groups (groups A, B, and C) have been identified by means of somatic cell fusion experiments. the defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC class II promoters Durand et al. (1997) isolated a novel gene that encodes the 36-kD subunit of RFX. They called this subunit RFX-associated protein (RFXAP) because it is a subunit of the RFX complex and interacts with RFX5, yet it does not contain the characteristic RFX DNA-binding motif.

Alternate Names

regulatory factor X-associated protein, RFX DNA-binding complex 36 kDa subunit, RFX-associated protein

Gene Symbol

RFXAP

Additional RFXAP Products

Product Documents for RFXAP Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RFXAP Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.