Skip to main content

Ring finger protein 138 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-86987PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-86987PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF138.

Source: E. coli

Amino Acid Sequence: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86987.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-86987PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: Ring finger protein 138

Ring finger protein 138 is 245 amino acids long, weighs approximately 28 kDa, and has a shorter isoform that is 151 amino acids long and weighs approximately 17 kDa. Ring finger protein 138 functions as E3 ubiquitin-protein ligases that works with NLK to ubiquitinate and degrade TCF and LEF. Current research is being done on diseases and disorders related to this protein including Crohn's disease and ataxia. Ring finger protein 138 has also been shown to have interactions with PCBP4, QKI, TAF9, C6orf165, and UBE2D2 in pathways such as the antigen processing, Wnt/beta-catenin-mediated signaling, and immune system pathways.

Alternate Names

E3 ubiquitin-protein ligase RNF138, EC 6.3.2.-, hNARF, HSD-4, MGC8758, NARF, Nemo-like kinase-associated RING finger protein, ring finger protein 138NLK-associated RING finger protein, STRIN

Gene Symbol

RNF138

Additional Ring finger protein 138 Products

Product Documents for Ring finger protein 138 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Ring finger protein 138 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...