RNF212 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-49259PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-49259PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all RNF212 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RNF212.

Source: E. coli

Amino Acid Sequence: KLLEFIKHVCYHRHQSHRPCAPGWFCQVLQRPGAVSGEKTQQTRPAPPATCLLCLSCLSGFRHGPWRSQALPSDLVAPLFVSYTVEVSITNAGWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49259.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-49259PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RNF212

RNF212, also known as Probable E3 SUMO-protein ligase RNF212, has 6 isoforms, a 297 amino acid isoform that is 33 kDa, a 123 amino acid isoform that is 14 kDa, a 192 amino acid isoform that is 22 kDa, a 280 amino acid isoform that is 31 kDa, a 232 amino acid isoform that is 26 kDa, and a 273 amino acid isoform that is 30 kDa. This protein may function as a ubiquitin ligase and may be involved in meiotic recombination, regulates crossing-over during meiosis: required to couple chromosome synapsis to the formation of crossover-specific recombination complexes, localizes to recombination sites and stabilizes meiosis-specific recombination factors, may act as a SUMO E3 ligase that mediates sumoylation of target proteins MSH4 and/or MSH5, leading to enhance their binding to recombination sites, and acts as a limiting factor for crossover designation and/or reinforcement.RNF212 protein is being studied for its involvement in recombination rate qtl 1 disorder. Little is currently known about this protein interactions with other proteins.

Alternate Names

FLJ38841, FLJ42587, hypothetical protein LOC285498, MGC120227, MGC120228, ring finger protein 212, ZHP3

Gene Symbol

RNF212

Additional RNF212 Products

Product Documents for RNF212 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RNF212 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.