Skip to main content

RREB1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81726PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-81726PEP

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RREB1.

Source: E. coli

Amino Acid Sequence: ATTDTNKFSPFLQTAEDNTQDEVAGAPADHHGPSDEEQGSPPEDKLLRAKRNSYTNCLQKITCPHCPRVFPWASSLQRHMLTHTGQKPFPCQKCDAFFSTKSNCERHQLRKHGVTIRRAPPLSNN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81726.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81726PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RREB1

RREB1 (also known as RAS-responsive element binding protein 1 and Raf responsive zinc finger protein) is a transcription factor that binds specifically to the distal RAS-responsive element (RRE) in the calcitonin gene promoter and augments the Ras/Raf-mediated transcriptional response of that promoter. RREB1 may be involved in Ras/Raf-mediated cell differentiation. RREB is a nuclear protein expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas and is not found in the brain. The protein contains 4 C2H2-type zinc fingers.

Alternate Names

DNA-binding protein, FINB, Finger protein in nuclear bodies, hindsight homolog, HNT, LZ321, Raf-responsive zinc finger protein LZ321, ras responsive element binding protein 1, ras-responsive element-binding protein 1, RREB-1, Zep-1, zinc finger motif enhancer binding protein 1, Zinc finger motif enhancer-binding protein 1, zinc finger motif-enhancer binding-protein 1

Gene Symbol

RREB1

Additional RREB1 Products

Product Documents for RREB1 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RREB1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...