RTVP-1/GLIPR1 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-81825PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP1-81825PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Tag

N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Conjugate

Unconjugated

Applications

Antibody Competition

View all RTVP-1 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLIPR1.

Source: E. coli

Amino Acid Sequence: NEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81825.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-81825PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: RTVP-1

The protein encoded by the GLIPR1 gene works as a proapoptic initiator in prostate and bladder cells. Not all variants of the GLIPR1 gene have been documented even though multiple isoforms have been described (isoform 1: 255 AA long, 30 kDA; isoform 2: 237 AA long, nearly 30 kDA). The glioma pathogenesis-related protein 1 provided by the GLIPR1 gene is related to both the pathogenesis-related protein (PR) superfamily as well as the cysteine-rich secretory protein (CRISP) family. GLIPR1 has been research regarding its role in Wilms tumors, neuronitis, prostatitis, leukemia, glioblastoma, astrocytoma where increased expression has been linked with myelomocytic differentiation in macrophage and decreased expression (through gene methylation) has been associated to prostate cancer. The GLIPR1 gene interacts with genes CHD9, NCOA2, NCOA6, CREBBP, and CARM1 to participate in metabolism, expression of GLIPR1 and PPARA activation gene expression.

Long Name

Related to Testis-specific Vespid and Pathogenesis Protein 1

Alternate Names

GLIPR1, RTVP1

Gene Symbol

GLIPR1

Additional RTVP-1 Products

Product Documents for RTVP-1/GLIPR1 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for RTVP-1/GLIPR1 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.