Recombinant Human RUNX1T1/ETO GST (N-Term) Protein

Name: Recombinant Human RUNX1T1/ETO GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000862-P01

Novus Biologicals, part of Bio-Techne | Catalog # H00000862-P01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all RUNX1T1/ETO Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-567 of Human RUNX1T1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPDSPVDVKTQSRLTPPTMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIETTPR

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

88 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human RUNX1T1/ETO GST (N-Term) Protein

SDS-PAGE: Recombinant Human RUNX1T1/ETO GST (N-Term) Protein [H00000862-P01]

SDS-Page: Recombinant Human RUNX1T1/ETO Protein [H00000862-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000862-P01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: RUNX1T1/ETO

The protein encoded by this gene is a putative zinc finger transcription factor and oncoprotein. In acute myeloid leukemia, especially in the M2 subtype, the t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities. The translocation produces a chimeric gene made up of the 5'-region of the RUNX1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Several transcript variants encoding multiple isoforms have been found for this gene. RUNX1T1( AAH05850, 1 a.a. - 568 a.a.) recombinant protein with .

Alternate Names

AML1T1protein CBFA2T1, CBFA2T1Cyclin-D-related protein, CDRMGC2796, core-binding factor, runt domain, alpha subunit 2; translocated to, 1; cyclinD-related, DKFZp564B213, Eight twenty one protein, ETOFLJ33145, MTG8acute myelogenous leukemia 1 translocation 1, cyclin-D related, Protein ETO, Protein MTG8, runt-related transcription factor 1; translocated to, 1 (cyclin D-related), Zinc finger MYND domain-containing protein 2, ZMYND2myeloid translocation gene on 8q22

Gene Symbol

RUNX1T1

Additional RUNX1T1/ETO Products

Product Documents for Recombinant Human RUNX1T1/ETO GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human RUNX1T1/ETO GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews