Skip to main content

Recombinant Human SAP30L GST (N-Term) Protein

Novus Biologicals, part of Bio-Techne | Catalog # H00079685-P01

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
H00079685-P01-10ug
H00079685-P01-25ug

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-183 of Human NS4ATP2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLAETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

47.3 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human SAP30L GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00079685-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: SAP30L

SAP30L is a novel TGF- beta up-regulated mRNA species, the Sin3-associated protein 30-like, SAP30L has been identified. The predicted nuclear localization signal of SAP30L is sufficient for nuclear transport of the protein although mutating it does not completely remove SAP30L from the nuclei. By reason of its nuclear localization and close homology to SAP30 it is thought that SAP30L might have a role in recruiting the Sin3-histone deacetylase complex to specific co-repressor complexes in response to TGF-beta, leading to the silencing of proliferation-driving genes in the differentiating intestinal epithelial cells.

Alternate Names

DKFZp667L2214, FLJ11526, FLJ36497, HCV non-structural protein 4A-transactivated protein 2, histone deacetylase complex subunit SAP30L, NS4ATP2FLJ23595, SAP30-like, Sin3 corepressor complex subunit SAP30L, Sin3A associated protein p30-like, Sin3-associated protein p30-like

Gene Symbol

SAP30L

Additional SAP30L Products

Product Documents for Recombinant Human SAP30L GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for Recombinant Human SAP30L GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...
Loading...