Skip to main content

SEC3 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP1-89957PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
Loading...
NBP1-89957PEP

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EXOC1.

Source: E. coli

Amino Acid Sequence: FKLQQHQSMPGTMAEAEDLDGGTLSRQHNCGTPLPVSSEKDMIRQMMIKIFRCIEPELNNLIALGDKIDSFNSLYMLVKMSHHVWTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89957.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP1-89957PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SEC3

The EXOC1 (also known as SEC3) gene encodes an exocyst complex component 1 protein, that in isoform 1 is 894 amino acids long and nearly 102 kDA and in isoform 2 is 879 amino acids long and 100 kDA. The EXOC1 gene functions in the docking of exocytic vesicles with fusion sites on the plasma membrane. EXOC1 participates in the insulin pathway, Arf6 trafficking events, exocyst complex formation, and the metabolism of proteins through interacts with genes EXOC4, PKP3, LUC7L2, CDC5L, and C7orf55-LUC7L2. EXOC1 has been linked to toxic shock syndrome, schizophrenia, and mucopolysaccharidosis.

Alternate Names

BM-102, exocyst complex component 1, Exocyst complex component Sec3, FLJ10893, SEC3L1, SEC3-like 1, SEC3-like 1 (S. cerevisiae), SEC3P, SEC3Sec3p

Gene Symbol

EXOC1

Additional SEC3 Products

Product Documents for SEC3 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SEC3 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Loading...
Loading...
Loading...