Recombinant Human Serotonin N-acetyltransferase GST (N-Term) Protein

Name: Recombinant Human Serotonin N-acetyltransferase GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00000015-Q01

Novus Biologicals, part of Bio-Techne | Catalog # H00000015-Q01

Submit a review

Product Datasheet / COA / SDS

100% Guarantee

Product Specifications
Scientific Data
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Conjugate

Unconjugated

Applications

ELISA, Affinity Purification, Microarray, Western Blot

View all Serotonin N-acetyltransferase Proteins and Enzymes »

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-79 of Human Serotonin N-acetyltransferase

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSTQSTHPLKPEAPRLPPGIPESPSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVCPLYLDEIRHFLTLCPE

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human Serotonin N-acetyltransferase GST (N-Term) Protein

SDS-PAGE: Recombinant Human Serotonin N-acetyltransferase GST (N-Term) Protein [H00000015-Q01]

SDS-Page: Recombinant Human Serotonin N-acetyltransferase Protein [H00000015-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation and Storage

H00000015-Q01

Preparation Method	in vitro wheat germ expression system
Formulation	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Concentration	Please see the vial label for concentration. If unlisted please contact technical services.
Shipping	The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage	Store at -80C. Avoid freeze-thaw cycles.

Background: Serotonin N-acetyltransferase

Arylalkylamine N-acetyltransferase belongs to the superfamily of acetyltransferases. It is the penultimate enzyme in melatonin synthesis and controls the night/day rhythm in melatonin production in the vertebrate pineal gland. Melatonin is essential for seasonal reproduction, modulates the function of the circadian clock in the suprachiasmatic nucleus, and influences activity and sleep. This enzyme is rapidly inactivated when animals are exposed to light at night. This protein is 80% identical to sheep and rat AA-NAT. Arylalkylamine N-acetyltransferase may contribute a multifactorial genetic diseases such as altered behavior in sleep/wake cycle. [provided by RefSeq]

Alternate Names

AA-NAT, aralkylamine N-acetyltransferaseEC 2.3.1.87, arylalkylamine N-acetyltransferase, Serotonin acetylase, SNATserotonin N-acetyltransferase

Gene Symbol

AANAT

Additional Serotonin N-acetyltransferase Products

Product Documents for Recombinant Human Serotonin N-acetyltransferase GST (N-Term) Protein

Product Datasheets

Download Product Datasheets

COA

SDS

Download SDS

Product Specific Notices for Recombinant Human Serotonin N-acetyltransferase GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations
Reviews