SLC35C2 Recombinant Protein Antigen

Novus Biologicals, part of Bio-Techne | Catalog # NBP2-32008PEP

Novus Biologicals, part of Bio-Techne
Catalog #
Availability
Size / Price
Qty
NBP2-32008PEP
Print Quote
Bulk Order
100% Guarantee

Key Product Details

Source

E. coli

Conjugate

Unconjugated

Applications

Antibody Competition

View all SLC35C2 Proteins and Enzymes »

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC35C2.

Source: E. coli

Amino Acid Sequence: KALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Applications

Antibody Competition (10 - 100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-32008.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation and Storage

NBP2-32008PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: SLC35C2

Oxygenation levels play an important role in the regulation of cellular invasiveness which occurs during early implantation when the trophoblast cells invade the uterus as well as during tumour progression and metastasis. This gene, which is regulated by oxygen tension, is induced in hypoxic trophoblast cells and is overexpressed in ovarian cancer. Two protein isoforms are encoded by transcript variants of this gene. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same isoform (a).

Alternate Names

BA394O2.1, C20orf5, CGI-15, FLJ37039, FLJ46434, MGC20633, MGC32079, MGC39183, ovarian cancer overexpressed 1, Ovarian cancer-overexpressed gene 1 protein, OVCOV1, solute carrier family 35 member C2, solute carrier family 35, member C2

Gene Symbol

SLC35C2

Additional SLC35C2 Products

Product Documents for SLC35C2 Recombinant Protein Antigen

Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot number in the search box below.

Product Specific Notices for SLC35C2 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Privacy and Cookie Policy
Site Map
© Copyright 2024 Bio-Techne. All Rights Reserved.